Home Provider Directory ✓ NPI-Verified Providers Methodology FAQ List Your Practice

Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL

Lakeland, FL
Unclaimed — Claim this listing
Ranks #435 of 604 providers in FL
3.0
out of 10.0
Needs Improvement
0510
medspaandwellnesscliniclakelandfl.com
G
Google Reviews
★ 5.0
48 reviews
● Operational
See on Google →
Address
On file
5143 S Lakeland Dr #2, Lakeland, FL 33813, USA
Medical Oversight
Medical oversight documented on provider website
Score Breakdown
Medical Oversight +1.5 pts
Rx Process Docs +1 pts available
Compounding Disclosed +0.75 pts available
Pharmacy Transparent +0.75 pts available
NPI Verified +1.5 pts available
Address Verified +1 pts available
Listing Claimed +2 pts available
Patient Reviews
What This Score Means For Patients

Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL demonstrates visible medical oversight. However, their listing shows no documented prescription process, no compounding disclosure and pharmacy sourcing not disclosed. They have excellent patient reviews (5.0/5 from 48 Google reviews). A score of 3.0/10 (needs improvement) means patients should carefully verify this provider's credentials and practices independently.

What We Know About This Provider
Website verified (medspaandwellnesscliniclakelandfl.com)
Google: ★5.0 (48 reviews) — Operational
NPI not verified
Address: 5143 S Lakeland Dr #2, Lakeland, FL 33813, USA
Phone: (863) 900-2081
Listing not yet claimed by provider
📊Score: 3.0/10 (Needs Improvement)
Services
Peptide Therapy
How to Improve This Score
+1.0 pts
Document your consultation & prescription process
🆓 Free
+0.75 pts
Disclose whether products are compounded or FDA-approved
🆓 Free
+0.75 pts
Identify your compounding pharmacy or medication source
🆓 Free
+2.0 pts
Claim listing + submit NPI for verification
📋 Claim
+1.0 pts
Ensure your address matches public records
📋 Claim
+2.0 pts
Claim your PepKey listing for trust score boost
📋 Claim
Claim your listing to start improving →
How PepKey Scores Work

PepKey independently evaluates every provider against 10 objective criteria spanning transparency, credential verification, and patient signal data. Scores are fully algorithmic and cannot be purchased or gamed.

Read our full scoring methodology →
✓ Claim This Listing Report an Issue